PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P07130_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 491aa    MW: 54317.4 Da    PI: 9.9739
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P07130_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-093473841954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+ +++  LAk++gLt +qV +WF N R +
  GSMUA_Achr6P07130_001 347 FEHflHPYPTDSDKFMLAKQTGLTRSQVANWFINARVR 384
                            564459******************************88 PP

2BELL115.23.4e-37219290172
                   BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            erqelq+kkakL+s+lee ++rY++y++q+qtvi+sFeavag+gsa+ Yt lA+++iS++FrcL+dai++qi
  GSMUA_Achr6P07130_001 219 ERQELQMKKAKLISMLEEAEQRYRKYNHQMQTVIASFEAVAGHGSARTYTVLAQRTISKQFRCLRDAIVGQI 290
                            79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-57157288IPR006563POX domain
PfamPF075264.6E-45163287IPR006563POX domain
PROSITE profilePS5007112.325325388IPR001356Homeobox domain
CDDcd000864.88E-12328389No hitNo description
SMARTSM003894.4E-10328392IPR001356Homeobox domain
SuperFamilySSF466895.99E-17329394IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27331393IPR009057Homeodomain-like
PfamPF059205.4E-18345384IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MATFIHGAPE VQPDGLQTLF LMNPGYAGYM DAAAPANMVL LNSTMNSLNP IILAQAGQPN  60
QQQQDFVGIP LQPAARLRDS DRPLPIHASH DASVLTRLHH NLWTPTPTSN SVDVASQFSP  120
RRRGLSLSLS PHEMAMTPGS AHEVMFAASV GGANGVSGRR SFLMGSKYLK AAQQLLDEVV  180
DVGKGIKDEA AKGPKSRNTE LKGGETTSTK QRADLTTAER QELQMKKAKL ISMLEEAEQR  240
YRKYNHQMQT VIASFEAVAG HGSARTYTVL AQRTISKQFR CLRDAIVGQI RATCKTLGEE  300
DTKLGNSRLR FIDQHLRQQR QMIQPNAWRP QRGLPERSVS VLRAWLFEHF LHPYPTDSDK  360
FMLAKQTGLT RSQVANWFIN ARVRLWKPMV EEIYLEETKH HEQRNADETA TKIDANGRST  420
SKQRIEEQAY PLIAGSSSQG GDHEAYPTFA SRFSGNGVSL TLGLQHSGNL SLSGAQPSIP  480
SSESIWAGGW R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B6e-16334392563Homeobox protein Meis2
3k2a_A6e-16334392563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6167418e-85JX616741.1 Gossypium hirsutum clone NBRI_GE61612 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009403681.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotO656851e-100BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLM0T4W20.0M0T4W2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P07130_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-101BEL1-like homeodomain 6